ADORA3 Rabbit pAb, Polyclonal

Catalog Number: ABB-A18524
Article Name: ADORA3 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18524
Supplier Catalog Number: A18524
Alternative Catalog Number: ABB-A18524-100UL,ABB-A18524-20UL,ABB-A18524-1000UL,ABB-A18524-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: A3AR, ADORA3
This gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates a sustained cardioprotective function during cardiac ischemia, it is involved in the inhibition of neutrophil degranulation in neutrophil-mediated tissue injury, it has been implicated in both neuroprotective and neurodegenerative effects, and it may also mediate both cell proliferation and cell death. Alternative splicing results in multiple transcript variants. This gene shares its 5 terminal exon with some transcripts from overlapping GeneID:57413, which encodes an immunoglobulin domain-containing protein.
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 140
UniProt: P0DMS8
Purity: Affinity purification
Sequence: FIVSLALADIAVGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKRVTTHRRIWLALGLCWLVSFLVGLTPMFGWN
Target: ADORA3
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Endocrine Metabolism,Neuroscience,Cardiovascular,Heart,Cardiovascular diseases,Heart disease. Shipping: Ice Bag
Western blot analysis of various lysates, using ADORA3 Rabbit pAb (A18524) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.