TMEM18 Rabbit pAb, Polyclonal

Catalog Number: ABB-A18541
Article Name: TMEM18 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18541
Supplier Catalog Number: A18541
Alternative Catalog Number: ABB-A18541-20UL,ABB-A18541-100UL,ABB-A18541-1000UL,ABB-A18541-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: lncND, TMEM18
Predicted to enable DNA binding activity. Involved in cell migration. Located in nuclear membrane.
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 129787
UniProt: Q96B42
Purity: Affinity purification
Sequence: LLTCLSSRSYRLQIGHFLCLVILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAP
Target: TMEM18
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using TMEM18 pAb (A18541) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.