WBP2NL Rabbit pAb, Polyclonal

Catalog Number: ABB-A18555
Article Name: WBP2NL Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18555
Supplier Catalog Number: A18555
Alternative Catalog Number: ABB-A18555-100UL,ABB-A18555-20UL,ABB-A18555-1000UL,ABB-A18555-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: PAWP, GRAMD7, WBP2NL
WBP2NL is a sperm-specific WW domain-binding protein that promotes meiotic resumption and pronuclear development during oocyte fertilization (Wu et al., 2007 [PubMed 17289678]).
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 164684
UniProt: Q6ICG8
Purity: Affinity purification
Sequence: MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNG
Target: WBP2NL
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Apoptosis. Shipping: Ice Bag
Western blot analysis of lysates from Rat spleen, using WBP2NL Rabbit pAb (A18555) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.