PRELP Rabbit pAb, Polyclonal
Catalog Number:
ABB-A18573
- Images (1)
| Article Name: | PRELP Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A18573 |
| Supplier Catalog Number: | A18573 |
| Alternative Catalog Number: | ABB-A18573-20UL,ABB-A18573-100UL,ABB-A18573-500UL,ABB-A18573-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | MST161, SLRR2A, MSTP161, PRELP |
| The protein encoded by this gene is a leucine-rich repeat protein present in connective tissue extracellular matrix. This protein functions as a molecule anchoring basement membranes to the underlying connective tissue. This protein has been shown to bind type I collagen to basement membranes and type II collagen to cartilage. It also binds the basement membrane heparan sulfate proteoglycan perlecan. This protein is suggested to be involved in the pathogenesis of Hutchinson-Gilford progeria (HGP), which is reported to lack the binding of collagen in basement membranes and cartilage. Alternatively spliced transcript variants encoding the same protein have been observed. |
| Clonality: | Polyclonal |
| Molecular Weight: | 44kDa |
| NCBI: | 5549 |
| UniProt: | P51888 |
| Purity: | Affinity purification |
| Sequence: | LDLQHNRLSDGVFKPDTFHGLKNLMQLNLAHNILRKMPPRVPTAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSHNRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVPHLRYLRLDGN |
| Target: | PRELP |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Bone. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PRELP Rabbit pAb (A18573) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
