POU3F2 Rabbit pAb, Polyclonal

Catalog Number: ABB-A18576
Article Name: POU3F2 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18576
Supplier Catalog Number: A18576
Alternative Catalog Number: ABB-A18576-100UL,ABB-A18576-20UL,ABB-A18576-1000UL,ABB-A18576-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: BRN2, OCT7, OTF7, OTF-7, POUF3, brn-2, oct-7, N-Oct3, POU3F2
This gene encodes a member of the POU-III class of neural transcription factors. The encoded protein is involved in neuronal differentiation and enhances the activation of corticotropin-releasing hormone regulated genes. Overexpression of this protein is associated with an increase in the proliferation of melanoma cells.
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 5454
UniProt: P20265
Purity: Affinity purification
Sequence: MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSHG
Target: POU3F2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using POU3F2 Rabbit pAb (A18576) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.