SLC22A3/OCT3 Rabbit pAb, Polyclonal

Catalog Number: ABB-A18588
Article Name: SLC22A3/OCT3 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18588
Supplier Catalog Number: A18588
Alternative Catalog Number: ABB-A18588-100UL,ABB-A18588-20UL,ABB-A18588-1000UL,ABB-A18588-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: EMT, EMTH, OCT3, SLC22A3/OCT3
Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein.
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 6581
UniProt: O75751
Purity: Affinity purification
Sequence: PESPRWLITRKKGDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRK
Target: SLC22A3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. Shipping: Ice Bag
Western blot analysis of lysates from Mouse liver, using SLC22A3/OCT3 Rabbit pAb (A18588) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.