MAFA Rabbit pAb, Polyclonal

Catalog Number: ABB-A18662
Article Name: MAFA Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18662
Supplier Catalog Number: A18662
Alternative Catalog Number: ABB-A18662-100UL,ABB-A18662-20UL,ABB-A18662-1000UL,ABB-A18662-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: INSDM, hMafA, RIPE3b1, MAFA
MAFA is a transcription factor that binds RIPE3b, a conserved enhancer element that regulates pancreatic beta cell-specific expression of the insulin gene (INS, MIM 176730) (Olbrot et al., 2002 [PubMed 12011435]).
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 389692
UniProt: Q8NHW3
Purity: Affinity purification
Sequence: QSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDLYKEKYEKLAGRGGPGSAGGAGFPREPSPPQAGPGGAKGTADFFL
Target: MAFA
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Growth factors. Shipping: Ice Bag
Western blot analysis of lysates from Mouse brain, using MAFA Rabbit pAb (A18662) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.