PYM1 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A18669
- Images (1)
| Article Name: | PYM1 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A18669 |
| Supplier Catalog Number: | A18669 |
| Alternative Catalog Number: | ABB-A18669-20UL,ABB-A18669-100UL,ABB-A18669-1000UL,ABB-A18669-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, IF, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | PYM, WIBG, PYM1 |
| Enables ribosome binding activity. Involved in exon-exon junction complex disassembly, nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, and positive regulation of translation. Located in cell junction, cytosol, and nuclear lumen. Part of exon-exon junction complex. |
| Clonality: | Polyclonal |
| Molecular Weight: | 23kDa |
| NCBI: | 84305 |
| UniProt: | Q9BRP8 |
| Purity: | Affinity purification |
| Sequence: | MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL |
| Target: | PYM1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PYM1 Rabbit pAb (A18669) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 90s. |
Product Guarantee and Expert Support
