PIGO Rabbit pAb, Polyclonal

Catalog Number: ABB-A18670
Article Name: PIGO Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18670
Supplier Catalog Number: A18670
Alternative Catalog Number: ABB-A18670-20UL,ABB-A18670-100UL,ABB-A18670-1000UL,ABB-A18670-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: HPMRS2, PIGO
This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. This protein is involved in the transfer of ethanolaminephosphate (EtNP) to the third mannose in GPI. At least three alternatively spliced transcripts encoding two distinct isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 119kDa
NCBI: 84720
UniProt: Q8TEQ8
Purity: Affinity purification
Sequence: FAVGCPLLLLWPFLCESQGLRKRQQPPGNEADARVRPEEEEEPLMEMRLRDAPQHFYAALLQLGLKYLFILGIQILACALAASILRRHLMVWKVFAPKFIF
Target: PIGO
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using PIGO Rabbit pAb (A18670) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.