FFAR4 Rabbit pAb, Polyclonal

Catalog Number: ABB-A18689
Article Name: FFAR4 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18689
Supplier Catalog Number: A18689
Alternative Catalog Number: ABB-A18689-20UL,ABB-A18689-100UL,ABB-A18689-500UL,ABB-A18689-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: GT01, PGR4, OB10Q, BMIQ10, GPR120, GPR129, O3FAR1, FFAR4
This gene encodes a G protein-coupled receptor (GPR) which belongs to the rhodopsin family of GPRs. The encoded protein functions as a receptor for free fatty acids, including omega-3, and participates in suppressing anti-inflammatory responses and insulin sensitizing. Multiple transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 338557
UniProt: Q5NUL3
Purity: Affinity purification
Sequence: NPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSIISG
Target: FFAR4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Endocrine Metabolism,Lipid Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using FFAR4 Rabbit pAb (A18689) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.