Pituitary homeobox 2 (PITX2) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1870
Article Name: Pituitary homeobox 2 (PITX2) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1870
Supplier Catalog Number: A1870
Alternative Catalog Number: ABB-A1870-20UL,ABB-A1870-100UL,ABB-A1870-1000UL,ABB-A1870-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RS, RGS, ARP1, Brx1, IDG2, IGDS, IHG2, PTX2, RIEG, ASGD4, IGDS2, IRID2, Otlx2, RIEG1, Pituitary homeobox 2 (PITX2)
This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 5308
UniProt: Q99697
Purity: Affinity purification
Sequence: MNCMKGPLHLEHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFT
Target: PITX2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Cardiovascular,Heart,Cardiogenesis. Shipping: Ice Bag
Western blot analysis of various lysates using Pituitary homeobox 2 (PITX2) Rabbit pAb (A1870) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.