TRIM5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1872
Article Name: TRIM5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1872
Supplier Catalog Number: A1872
Alternative Catalog Number: ABB-A1872-20UL,ABB-A1872-100UL,ABB-A1872-500UL,ABB-A1872-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RNF88, TRIM5alpha, TRIM5
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein forms homo-oligomers via the coilel-coil region and localizes to cytoplasmic bodies. It appears to function as a E3 ubiquitin-ligase and ubiqutinates itself to regulate its subcellular localization. It may play a role in retroviral restriction. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Clonality: Polyclonal
Molecular Weight: 56kDa
NCBI: 85363
UniProt: Q9C035
Purity: Affinity purification
Sequence: EKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNEL
Target: TRIM5
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Cell Cycle,Ubiquitin,Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of various lysates using TRIM5 Rabbit pAb (A1872) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.