Papillary renal cell carcinoma Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A18781
- Images (1)
| Article Name: | Papillary renal cell carcinoma Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A18781 |
| Supplier Catalog Number: | A18781 |
| Alternative Catalog Number: | ABB-A18781-100UL,ABB-A18781-20UL,ABB-A18781-1000UL,ABB-A18781-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | TPRC, RCCP1, Papillary renal cell carcinoma |
| This gene encodes a protein that may play a role in pre-mRNA splicing. Chromosomal translocations (X,1)(p11,q21) that result in fusion of this gene to TFE3 (GeneID 7030) have been associated with papillary renal cell carcinoma. A PRCC-TFE3 fusion protein is expressed in affected carcinomas and is likely associated with altered gene transactivation. This fusion protein has also been associated with disruption of the cell cycle. |
| Clonality: | Polyclonal |
| Molecular Weight: | 52kDa |
| NCBI: | 5546 |
| UniProt: | Q92733 |
| Purity: | Affinity purification |
| Sequence: | PSPSAIKAAAKSAALQVTKQITQEEDDSDEEVAPENFFSLPEKAEPPGVEPYPYPIPTVPEELPPGTEPEPAFQDDAANAPLEFKMAAGSSGAPWMPKPGDDYSYNQFSTYGDANAAGAYYQDYYSGGYYPAQDPALVPPQEIAPDASFIDDEAFKRLQGKRNRGREEINFVEIKGDDQLSGAQQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKYGF |
| Target: | PRCC |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Cancer,Tumor immunology,Tumor-associated antigens,Immunology Inflammation. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from HeLa cells, using Papillary renal cell carcinoma Rabbit pAb (A18781) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 180s. |
Product Guarantee and Expert Support
