SHH Rabbit pAb, Polyclonal

Catalog Number: ABB-A18863
Article Name: SHH Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18863
Supplier Catalog Number: A18863
Alternative Catalog Number: ABB-A18863-20UL,ABB-A18863-100UL,ABB-A18863-1000UL,ABB-A18863-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: Hx, Dsh, Hhg1, Hxl3, ShhNC, M100081, 9530036O11Rik, SHH
Enables glycosaminoglycan binding activity, laminin-1 binding activity, and patched binding activity. Involved in several processes, including hematopoietic or lymphoid organ development, positive regulation of T cell activation, and regulation of smooth muscle cell differentiation. Acts upstream of or within several processes, including animal organ development, limb morphogenesis, and neurogenesis. Located in several cellular components, including cell surface, extracellular space, and membrane raft. Is expressed in several structures, including alimentary system, central nervous system, genitourinary system, limb bud, and sensory organ. Used to study brachydactyly type A1 and holoprosencephaly 3. Human ortholog(s) of this gene implicated in several diseases, including Hirschsprungs disease, holoprosencephaly (multiple), hypoplastic or aplastic tibia with polydactyly, middle cerebral artery infarction, and polydactyly. Orthologous to human SHH (sonic hedgehog signaling molecule).
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 20423
UniProt: Q62226
Purity: Affinity purification
Sequence: KAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSDFLTFLDRDEGAKKVFYVIETLEPRERLLLTAAHLLFVAPHNDS
Target: Shh
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using SHH Rabbit pAb (A18863) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.