NAT10 Rabbit mAb, Unconjugated, Monoclonal
Catalog Number:
ABB-A19286
- Images (8)
| Article Name: | NAT10 Rabbit mAb, Unconjugated, Monoclonal |
| Biozol Catalog Number: | ABB-A19286 |
| Supplier Catalog Number: | A19286 |
| Alternative Catalog Number: | ABB-A19286-100UL,ABB-A19286-20UL,ABB-A19286-500UL,ABB-A19286-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, IHC-P, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | ALP, Kre33, NET43, NAT10 |
| The protein encoded by this gene is an RNA cytidine acetyltransferase involved in histone acetylation, tRNA acetylation, the biosynthesis of 18S rRNA, and the enhancement of nuclear architecture and chromatin organization. |
| Clonality: | Monoclonal |
| Clone Designation: | [ARC2468] |
| Molecular Weight: | 116 kDa |
| NCBI: | 55226 |
| UniProt: | Q9H0A0 |
| Purity: | Affinity purification |
| Sequence: | KTLTDEDEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIRKVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQ |
| Target: | NAT10 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:1000 - 1:10000|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,RNA Binding,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cytoskeleton,Microtubules,Immunology Inflammation,Cytokines. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse testis, using NAT10 Rabbit mAb (A19286) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using NAT10 Rabbit mAb (A19286) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Western blot analysis of various lysates using NAT10 Rabbit mAb (A19286) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon using NAT10 Rabbit mAb (A19286) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using NAT10 Rabbit mAb (A19286) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using NAT10 Rabbit mAb (A19286) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse liver using NAT10 Rabbit mAb (A19286) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat spleen using NAT10 Rabbit mAb (A19286) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining. |
Product Guarantee and Expert Support
