PP2A-B56beta/PR61beta/PPP2R5B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A19332
Article Name: PP2A-B56beta/PR61beta/PPP2R5B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A19332
Supplier Catalog Number: A19332
Alternative Catalog Number: ABB-A19332-100UL,ABB-A19332-20UL,ABB-A19332-1000UL,ABB-A19332-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: B56B, PR61B, B56beta, PP2A-B56beta/PR61beta/PPP2R5B
The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a beta isoform of the regulatory subunit B56 subfamily.
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 5526
UniProt: Q15173
Purity: Affinity purification
Sequence: AVFGTLYQVSKEHWNQTIVSLIYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTPQVAASGGQS
Target: PPP2R5B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from Rat brain usingPP2A-B56beta/PR61beta/PPP2R5B Rabbit pAb (A19332) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.