EBAG9 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A1935
- Images (1)
| Article Name: | EBAG9 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A1935 |
| Supplier Catalog Number: | A1935 |
| Alternative Catalog Number: | ABB-A1935-20UL,ABB-A1935-100UL,ABB-A1935-1000UL,ABB-A1935-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | EB9, PDAF, EBAG9 |
| This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor, which binds to the estrogen-responsive element found in the 5-flanking region of this gene. The encoded protein is a tumor-associated antigen that is expressed at high frequency in a variety of cancers. Alternate splicing results in multiple transcript variants. A pseudogene of this gene has been defined on chromosome 10. |
| Clonality: | Polyclonal |
| Molecular Weight: | 24kDa |
| NCBI: | 9166 |
| UniProt: | O00559 |
| Purity: | Affinity purification |
| Sequence: | RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS |
| Target: | EBAG9 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor immunology,Tumor-associated antigens,Tumor biomarkers,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Growth factors,Immunology Inflammation. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using EBAG9 Rabbit pAb (A1935) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. |
Product Guarantee and Expert Support
