CD3G Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1938
Article Name: CD3G Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1938
Supplier Catalog Number: A1938
Alternative Catalog Number: ABB-A1938-100UL,ABB-A1938-20UL,ABB-A1938-500UL,ABB-A1938-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: T3G, IMD17, CD3GAMMA, CD3-GAMMA, CD3G
The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency.
Clonality: Polyclonal
Molecular Weight: 20kDa
NCBI: 917
UniProt: P09693
Purity: Affinity purification
Sequence: QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS
Target: CD3G
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,CDs,T Cell Receptor Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates, using CD3G Rabbit pAb (A1938) at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.