GRIK2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A1939
- Images (1)
| Article Name: | GRIK2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A1939 |
| Supplier Catalog Number: | A1939 |
| Alternative Catalog Number: | ABB-A1939-20UL,ABB-A1939-100UL,ABB-A1939-1000UL,ABB-A1939-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | EAA4, GLR6, MRT6, GLUK6, GLUR6, GluK2, NEDLAS, GRIK2 |
| Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing at multiple sites within the first and second transmembrane domains, which is thought to alter the structure and function of the receptor complex. Alternatively spliced transcript variants encoding different isoforms have also been described for this gene. Mutations in this gene have been associated with autosomal recessive cognitive disability. |
| Clonality: | Polyclonal |
| Molecular Weight: | 103kDa |
| NCBI: | 2898 |
| UniProt: | Q13002 |
| Purity: | Affinity purification |
| Sequence: | QGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNT |
| Target: | GRIK2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Cell Biology Developmental Biology,Apoptosis,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using GRIK2 Rabbit pAb (A1939) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. |
Product Guarantee and Expert Support
