EI24 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A19437
Article Name: EI24 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A19437
Supplier Catalog Number: A19437
Alternative Catalog Number: ABB-A19437-20UL,ABB-A19437-100UL,ABB-A19437-500UL,ABB-A19437-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: EPG4, PIG8, TP53I8, EI24
This gene encodes a putative tumor suppressor and has higher expression in p53-expressing cells than in control cells and is an immediate-early induction target of p53-mediated apoptosis. The encoded protein may suppress cell growth by inducing apoptotic cell death through the caspase 9 and mitochondrial pathways. This gene is located on human chromosome 11q24, a region frequently altered in cancers. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 1, 3, 7, and 8.
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 9538
UniProt: O14681
Purity: Affinity purification
Sequence: PYYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATAGH
Target: EI24
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor suppressors,p53 pathway,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell cycle inhibitors. Shipping: Ice Bag
Western blot analysis of various lysates, using EI24 Rabbit pAb (A19437) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.