KAP1/TRIM28 Rabbit mAb, Unconjugated, Monoclonal

Catalog Number: ABB-A19568
Article Name: KAP1/TRIM28 Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A19568
Supplier Catalog Number: A19568
Alternative Catalog Number: ABB-A19568-100UL,ABB-A19568-20UL,ABB-A19568-1000UL,ABB-A19568-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: KAP1, TF1B, RNF96, TIF1B, PPP1R157, TIF1beta, KAP1/TRIM28
The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromatin regions. The protein is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.
Clonality: Monoclonal
Clone Designation: [ARC0047]
Molecular Weight: 89 kDa
NCBI: 10155
UniProt: Q13263
Purity: Affinity purification
Sequence: RNQRKLLASLVKRLGDKHATLQKSTKEVRSSIRQVSDVQKRVQVDVKMAILQIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFAS
Target: TRIM28
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:10000|IHC-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Apoptosis,Ubiquitin. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Western blot analysis of various lysates using KAP1/TRIM28 Rabbit mAb (A19568) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse intestin using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.