Raf1 Rabbit mAb, Unconjugated, Monoclonal

Catalog Number: ABB-A19638
Article Name: Raf1 Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A19638
Supplier Catalog Number: A19638
Alternative Catalog Number: ABB-A19638-100UL,ABB-A19638-20UL,ABB-A19638-1000UL,ABB-A19638-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: NS5, CRAF, Raf-1, c-Raf, CMD1NN, Raf1
This gene is the cellular homolog of viral raf gene (v-raf). The encoded protein is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. Once activated, the cellular RAF1 protein can phosphorylate to activate the dual specificity protein kinases MEK1 and MEK2, which in turn phosphorylate to activate the serine/threonine specific protein kinases, ERK1 and ERK2. Activated ERKs are pleiotropic effectors of cell physiology and play an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration. Mutations in this gene are associated with Noonan syndrome 5 and LEOPARD syndrome 2.
Clonality: Monoclonal
Clone Designation: [ARC0117]
Molecular Weight: 73kDa
NCBI: 5894
UniProt: P04049
Purity: Affinity purification
Sequence: MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFR
Target: RAF1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Kinase,Serine threonine kinases,ErbB-HER Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Inhibition of Apoptosis,Growth factors,ESC Pluripotency and Differentiation,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Insulin Receptor Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway,Jak-Stat-IL-6 Receptor Signaling Pathway,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using Raf1 Rabbit mAb (A19638) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.