TCF3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20013
Article Name: TCF3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20013
Supplier Catalog Number: A20013
Alternative Catalog Number: ABB-A20013-100UL,ABB-A20013-20UL,ABB-A20013-1000UL,ABB-A20013-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: E2A, E47, p75, AGM8, ITF1, VDIR, AGM8A, AGM8B, TCF-3, bHLHb21, TCF3
This gene encodes a member of the E protein (class I) family of helix-loop-helix transcription factors. E proteins activate transcription by binding to regulatory E-box sequences on target genes as heterodimers or homodimers, and are inhibited by heterodimerization with inhibitor of DNA-binding (class IV) helix-loop-helix proteins. E proteins play a critical role in lymphopoiesis, and the encoded protein is required for B and T lymphocyte development. Deletion of this gene or diminished activity of the encoded protein may play a role in lymphoid malignancies. This gene is also involved in several chromosomal translocations that are associated with lymphoid malignancies including pre-B-cell acute lymphoblastic leukemia (t(1,19), with PBX1), childhood leukemia (t(19,19), with TFPT) and acute leukemia (t(12,19), with ZNF384). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9.
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 6929
UniProt: P15923
Purity: Affinity purification
Sequence: DGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPR
Target: TCF3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Cell Adhesion,Wnt -Catenin Signaling Pathway,Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using TCF3 Rabbit pAb (A20013) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.