PHACTR1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A20154
- Images (1)
| Article Name: | PHACTR1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A20154 |
| Supplier Catalog Number: | A20154 |
| Alternative Catalog Number: | ABB-A20154-100UL,ABB-A20154-20UL,ABB-A20154-500UL,ABB-A20154-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | RPEL, DEE70, RPEL1, EIEE70, dJ257A7.2, PHACTR1 |
| The protein encoded by this gene is a member of the phosphatase and actin regulator family of proteins. This family member can bind actin and regulate the reorganization of the actin cytoskeleton. It plays a role in tubule formation and in endothelial cell survival. Polymorphisms in this gene are associated with susceptibility to myocardial infarction, coronary artery disease and cervical artery dissection. Alternative splicing of this gene results in multiple transcript variants. |
| Clonality: | Polyclonal |
| Molecular Weight: | 66kDa |
| NCBI: | 221692 |
| UniProt: | Q9C0D0 |
| Purity: | Affinity purification |
| Sequence: | IKRGVLKEIYDKDGELSISNEEDSLENGQSLSSSQLSLPALSEMEPVPMPRDPCSYEVLQPSDIMDGPDPGAPVKLPCLPVKLSPPLPPKKVMICMPVGGPDLSLVSYTAQKSGQQGVAQHHHTVLPSQIQHQLQYGSHGQHLPSTTGSLPMHPSGCRMIDELNKTLAMTMQRLESSEQRVPCSTSYHSSGLHSGDGVTKAGPMGLPEIRQVPTVVIECDDNKENVP |
| Target: | PHACTR1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cytoskeleton,Microfilaments. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PHACTR1 Rabbit pAb (A20154) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s. |
Product Guarantee and Expert Support
