HASPIN Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A20180
- Images (1)
| Article Name: | HASPIN Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A20180 |
| Supplier Catalog Number: | A20180 |
| Alternative Catalog Number: | ABB-A20180-100UL,ABB-A20180-20UL,ABB-A20180-500UL,ABB-A20180-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | GSG2, HASPIN |
| Enables ATP binding activity and histone kinase activity (H3-T3 specific). Involved in histone H3-T3 phosphorylation involved in chromosome passenger complex localization to kinetochore, intracellular signal transduction, and mitotic sister chromatid cohesion. Located in centrosome, nucleoplasm, and spindle. |
| Clonality: | Polyclonal |
| Molecular Weight: | 88kDa |
| NCBI: | 83903 |
| UniProt: | Q8TF76 |
| Purity: | Affinity purification |
| Sequence: | GKRRATGQDSCQERGLQEAVRREHQEASVPKGRIVPRGIDRLERTRSSRKSKHQEATETSLLHSHRFKKGQKLGKDSFPTQDLTPLQNVCFWTKTRASFSFHKKKIVTDVSEVCSIYTTATSLSGSLLSECSNRPVMNRTSGAPSSWHSSSMYLLSPLNTLSISNKKASDAEKVYGECSQK |
| Target: | HASPIN |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Signal Transduction,Kinase,Cell Biology Developmental Biology,Cell Cycle,Centrosome. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using HASPIN Rabbit pAb (A20180) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
