RAD54L Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20181
Article Name: RAD54L Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20181
Supplier Catalog Number: A20181
Alternative Catalog Number: ABB-A20181-100UL,ABB-A20181-20UL,ABB-A20181-500UL,ABB-A20181-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HR54, hHR54, RAD54A, hRAD54, RAD54L
The protein encoded by this gene belongs to the DEAD-like helicase superfamily, and shares similarity with Saccharomyces cerevisiae Rad54, a protein known to be involved in the homologous recombination and repair of DNA. This protein has been shown to play a role in homologous recombination related repair of DNA double-strand breaks. The binding of this protein to double-strand DNA induces a DNA topological change, which is thought to facilitate homologous DNA paring, and stimulate DNA recombination. Alternative splicing results in multiple transcript variants encoding the same protein.
Clonality: Polyclonal
Molecular Weight: 84kDa
NCBI: 8438
UniProt: Q92698
Purity: Affinity purification
Sequence: EEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQRGLR
Target: RAD54L
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair. Shipping: Ice Bag
Western blot analysis of various lysates using RAD54L Rabbit pAb (A20181) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.