ALPK1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A20310
- Images (1)
| Article Name: | ALPK1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A20310 |
| Supplier Catalog Number: | A20310 |
| Alternative Catalog Number: | ABB-A20310-100UL,ABB-A20310-20UL,ABB-A20310-1000UL,ABB-A20310-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | LAK, ROSAH, 8430410J10Rik, ALPK1 |
| This gene encodes an alpha kinase. Mice which were homozygous for disrupted copies of this gene exhibited coordination defects (PMID: 21208416). Multiple transcript variants encoding different isoforms have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 139kDa |
| NCBI: | 80216 |
| UniProt: | Q96QP1 |
| Purity: | Affinity purification |
| Sequence: | RDDEPVTGKQELHSFVKAAFGLTTVHRRLHGETGTVHAASQLCKEAMGKLYNFSTSSRSQDREALSQEVMSVIAQVKEHLQVQSFSNVDDRSYVPESFECRLDKLILHGQGDFQKILDTYSQHHTSVCEVFESDCGNNKNEQKDAKTGVCITALKTEIKNI |
| Target: | ALPK1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ALPK1 Rabbit pAb (A20310) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Product Guarantee and Expert Support
