TIGIT Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20350
Article Name: TIGIT Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20350
Supplier Catalog Number: A20350
Alternative Catalog Number: ABB-A20350-100UL,ABB-A20350-20UL,ABB-A20350-1000UL,ABB-A20350-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: VSIG9, VSTM3, WUCAM, TIGIT
This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity, this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.
Clonality: Polyclonal
Molecular Weight: 26kDa
NCBI: 201633
UniProt: Q495A1
Purity: Affinity purification
Sequence: KKALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGLCGEQRGEDCAELHDYFNVLSYRSLGNCSFFTETG
Target: TIGIT
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using TIGIT Rabbit pAb (A20350) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.