PVRL1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A2037
Article Name: PVRL1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A2037
Supplier Catalog Number: A2037
Alternative Catalog Number: ABB-A2037-100UL,ABB-A2037-20UL,ABB-A2037-1000UL,ABB-A2037-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ED4, PRR, HIgR, HV1S, HVEC, OFC7, PRR1, PVRR, CD111, PVRL1, PVRR1, SK-12, CLPED1, nectin-1
This gene encodes an adhesion protein that plays a role in the organization of adherens junctions and tight junctions in epithelial and endothelial cells. The protein is a calcium(2+)-independent cell-cell adhesion molecule that belongs to the immunoglobulin superfamily and has 3 extracellular immunoglobulin-like loops, a single transmembrane domain (in some isoforms), and a cytoplasmic region. This protein acts as a receptor for glycoprotein D (gD) of herpes simplex viruses 1 and 2 (HSV-1, HSV-2), and pseudorabies virus (PRV) and mediates viral entry into epithelial and neuronal cells. Mutations in this gene cause cleft lip and palate/ectodermal dysplasia 1 syndrome (CLPED1) as well as non-syndromic cleft lip with or without cleft palate (CL/P). Alternative splicing results in multiple transcript variants encoding proteins with distinct C-termini.
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 5818
UniProt: Q15223
Purity: Affinity purification
Sequence: ERKVGGPHPKYDEDAKRPYFTVDEAEARQDGYGDRTLGYQYDPEQLDLAENMVSQNDGSFISKKEWYV
Target: NECTIN1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Adhesion,Immunology Inflammation,CDs,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using PVRL1 Rabbit pAb (A2037) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.