MSY2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20378
Article Name: MSY2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20378
Supplier Catalog Number: A20378
Alternative Catalog Number: ABB-A20378-20UL,ABB-A20378-100UL,ABB-A20378-500UL,ABB-A20378-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DBPC, MSY2, CSDA3, CONTRIN
This gene encodes a nucleic acid binding protein which is highly expressed in germ cells. The encoded protein binds to a Y-box element in the promoters of certain genes but also binds to mRNA transcribed from these genes. Pseudogenes for this gene are located on chromosome 10 and 15.
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 51087
UniProt: Q9Y2T7
Purity: Affinity purification
Sequence: MSEVEAAAGATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKW
Target: YBX2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Stem Cells,Germline Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using MSY2 Rabbit pAb (A20378) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.