HCoV-229E Spike S2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20394
Article Name: HCoV-229E Spike S2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20394
Supplier Catalog Number: A20394
Alternative Catalog Number: ABB-A20394-100UL,ABB-A20394-20UL,ABB-A20394-1000UL,ABB-A20394-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Virus
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
S1 region attaches the virion to the cell membrane by interacting with host ANPEP/aminopeptidase N, initiating the infection. Binding to the receptor probably induces conformational changes in the S glycoprotein unmasking the fusion peptide of S2 region and activating membranes fusion. S2 region belongs to the class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats regions assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.
Clonality: Polyclonal
Molecular Weight: 129kDa
NCBI: 918758
UniProt: P15423
Purity: Affinity purification
Sequence: LENKSAELNYTVQKLQTLIDNINSTLVDLKWLNRVETYIKWPWWVWLCISVVLIFVVSMLLLCCCSTGCCGFFSCFASSIRGCCESTKLPYYDVEKIHIQ
Target: HCoV-229E Spike S2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: HCoV-229E. Shipping: Ice Bag
Western blot analysis of lysates from Human coronavirus (HCoV-229E) Spike Protein (S1+S2 ECDHis Tag), using HCoV-229E Spike S2 Rabbit pAb (A20394) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.