TARBP1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A20524
- Images (1)
| Article Name: | TARBP1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A20524 |
| Supplier Catalog Number: | A20524 |
| Alternative Catalog Number: | ABB-A20524-20UL,ABB-A20524-100UL,ABB-A20524-1000UL,ABB-A20524-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | TRM3, TRMT3, TRP185, TRP-185, TARBP1 |
| HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. This element forms a stable stem-loop structure and can be bound by either the protein encoded by this gene or by RNA polymerase II. This protein may act to disengage RNA polymerase II from TAR during transcriptional elongation. Alternatively spliced transcripts of this gene may exist, but their full-length natures have not been determined. |
| Clonality: | Polyclonal |
| Molecular Weight: | 182kDa |
| NCBI: | 6894 |
| UniProt: | Q13395 |
| Purity: | Affinity purification |
| Sequence: | QVESMHGAGNAKKNWQRIQEHFFFATFHPLKDYCLETIFYILPRLSGLIEDEWITIDKFTRFTDVPLAAGFQWYLSQTQLSKLKPGDWSQQDIGTNLVEADNQAEWTDVQKKIIPWNSRVSDLDLELLFQDRAARLGKSISRLIVVASLIDKPTNLGGLCRTCEVFGASVLVVGSLQCISDKQFQHLSVSAEQWLPLVEVKPPQLIDYLQQKKTEGYTIIGVEQTAKSLDLTQYCFPEKSLLLLGNEREGIPANL |
| Target: | TARBP1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Immunology Inflammation. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using TARBP1 Rabbit pAb (A20524) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
