CYP39A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20530
Article Name: CYP39A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20530
Supplier Catalog Number: A20530
Alternative Catalog Number: ABB-A20530-100UL,ABB-A20530-20UL,ABB-A20530-500UL,ABB-A20530-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CYP39A1
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein is involved in the conversion of cholesterol to bile acids. Its substrates include the oxysterols 25-hydroxycholesterol, 27-hydroxycholesterol and 24-hydroxycholesterol. Alternate splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 51302
UniProt: Q9NYL5
Purity: Affinity purification
Sequence: MELISPTVIIILGCLALFLLLQRKNLRRPPCIKGWIPWIGVGFEFGKAPLEFIEKARIKYGPIFTVFAMGNRMTFVTEEEGINVFLKSKKVDFELAVQNI
Target: CYP39A1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Lipid Metabolism,Cholesterol Metabolism,Lipases,Cardiovascular,Lipids. Shipping: Ice Bag
Western blot analysis of various lysates using CYP39A1 Rabbit pAb (A20530) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.