SARS-CoV Spike RBD Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20606
Article Name: SARS-CoV Spike RBD Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20606
Supplier Catalog Number: A20606
Alternative Catalog Number: ABB-A20606-100UL,ABB-A20606-20UL,ABB-A20606-500UL,ABB-A20606-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Virus
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: E2, SARS-CoV Spike RBD, sars-cov
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2, DPP4, dipeptidyl peptidase-4, APN, aminopeptidase N, CEACAM, carcinoembryonic antigen-related cell adhesion molecule 1, Sia, sialic acid, O-ac Sia, O-acetylated sialic acid. The spike is essential for both host specificity and viral infectivity. The term peplomer is typically used to refer to a grouping of heterologous proteins on the virus surface that function together. The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. Its been reported that SARS-CoV-2 (COVID-19 coronavirus, 2019-nCoV) can infect the human respiratory epithelial cells through interaction with the human ACE2 receptor.
Clonality: Polyclonal
Molecular Weight: 139kDa
NCBI: 1489668
UniProt: P59594
Purity: Affinity purification
Sequence: ADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRP
Target: Spike RBD
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: SARS-CoV. Shipping: Ice Bag
Western blot analysis of various lysates using SARS-CoV Spike RBD Rabbit pAb (A20606) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.