HCoV-HKU1 Nucleoprotein Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20612
Article Name: HCoV-HKU1 Nucleoprotein Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20612
Supplier Catalog Number: A20612
Alternative Catalog Number: ABB-A20612-100UL,ABB-A20612-20UL,ABB-A20612-1000UL,ABB-A20612-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Virus
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 3200423
UniProt: Q5MQC6
Purity: Affinity purification
Sequence: WYRHSRRSFKTADGQQKQLLPRWYFYYLGTGPYANASYGESLEGVFWVANHQADTSTPSDVSSRDPTTQEAIPTRFPPGTILPQGYYVEGSGRSASNSRPG
Target: HCoV-HKU1 Nucleoprotein
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: HCoV-HKU1. Shipping: Ice Bag
Western blot analysis of lysates from Human coronavirus (HCoV-HKU1) Nucleocapsid Protein (His Tag), using HCoV-HKU1 Nucleoprotein Rabbit pAb (A20612) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.