HCoV-HKU1 Spike S1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A20613
| Article Name: |
HCoV-HKU1 Spike S1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
ABB-A20613 |
| Supplier Catalog Number: |
A20613 |
| Alternative Catalog Number: |
ABB-A20613-20UL,ABB-A20613-100UL,ABB-A20613-1000UL,ABB-A20613-500UL |
| Manufacturer: |
ABclonal |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ELISA, WB |
| Species Reactivity: |
Virus |
| Immunogen: |
Synthetic peptide. This information is considered to be commercially sensitive. |
| Conjugation: |
Unconjugated |
| [Spike protein S1]: attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. |
| Clonality: |
Polyclonal |
| Molecular Weight: |
152kDa |
| NCBI: |
3200426 |
| UniProt: |
Q5MQD0 |
| Purity: |
Affinity purification |
| Sequence: |
NGIFSRVKNTKLYVNKTLYSEFSTIVIGSVFINNSYTIVVQPHNGVLEITACQYTMCEYPHTICKSKGSSRNESWHFDKSEPLCLFKKNFTYNVSTDWLYF |
| Target: |
HCoV-HKU1 Spike S1 |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: |
Cross-Reactivity: HCoV-HKU1. Shipping: Ice Bag |
|
Western blot analysis of lysates from Human coronavirus HKU1 (isolate N5) (HCoV-HKU1) Spike Protein (S1+S2 ECDHis Tag), using HCoV-HKU1 Spike S1 Rabbit pAb (A20613) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |