HCoV-OC43 Spike S2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20616
Article Name: HCoV-OC43 Spike S2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20616
Supplier Catalog Number: A20616
Alternative Catalog Number: ABB-A20616-100UL,ABB-A20616-20UL,ABB-A20616-500UL,ABB-A20616-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Virus
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
S1 attaches the virion to the cell membrane by interacting with sialic acid-containing cell receptors, initiating the infection., [Spike protein S1]: attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.
Clonality: Polyclonal
Molecular Weight: 150kDa
NCBI: 39105218
UniProt: P36334
Purity: Affinity purification
Sequence: EPVGGLYEIQIPSEFTIGNMVEFIQTSSPKVTIDCAAFVCGDYAACKSQLVEYGSFCDNINAILTEVNELLDTTQLQVANSLMNGVTLSTKLKDGVNFNV
Target: HCoV-OC43 Spike S2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: HCoV-OC43. Shipping: Ice Bag
Western blot analysis of lysates from Human coronavirus (HCoV-OC43) Spike Protein (S1+S2 ECDHis Tag), using HCoV-OC43 Spike S2 Rabbit pAb (A20616) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.