EPHX1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A2070
- Images (1)
| Article Name: | EPHX1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A2070 |
| Supplier Catalog Number: | A2070 |
| Alternative Catalog Number: | ABB-A2070-20UL,ABB-A2070-100UL,ABB-A2070-500UL,ABB-A2070-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | MEH, EPHX, EPOX, HYL1, EPHX1 |
| Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 53kDa |
| NCBI: | 2052 |
| UniProt: | P07099 |
| Purity: | Affinity purification |
| Sequence: | SRDKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHTPKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNMALVLSNFSTLTLLLGQRFGRFLGL |
| Target: | EPHX1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Endocrine Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using EPHX1 Rabbit pAb (A2070) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. |
Product Guarantee and Expert Support
