IL10 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A20723
- Images (1)
| Article Name: | IL10 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A20723 |
| Supplier Catalog Number: | A20723 |
| Alternative Catalog Number: | ABB-A20723-100UL,ABB-A20723-20UL,ABB-A20723-500UL,ABB-A20723-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CSIF, If2a, Il-10, IL10 |
| This gene encodes an anti-inflammatory cytokine that is a member of the class-2 cytokine family. The encoded protein is secreted by cells of both the innate and adaptive immune systems and is crucial for limiting the immune response to a broad range of pathogens. It also has been shown to suppress autoimmune responses. This protein mediates its immunosuppressive signal through a specific interleukin 10 receptor complex. Aberrant functioning of this gene is associated with numerous immune disorders including graft-versus-host disease, and increased susceptibility to HIV-1 infection and rheumatoid arthritis. |
| Clonality: | Polyclonal |
| Molecular Weight: | 21kDa |
| NCBI: | 16153 |
| UniProt: | P18893 |
| Purity: | Affinity purification |
| Sequence: | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS |
| Target: | Il10 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using IL10 Rabbit pAb (A20723) at 1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
