Pin1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A2106
- Images (1)
| Article Name: | Pin1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A2106 |
| Supplier Catalog Number: | A2106 |
| Alternative Catalog Number: | ABB-A2106-20UL,ABB-A2106-100UL,ABB-A2106-1000UL,ABB-A2106-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | DOD, UBL5, Pin1 |
| Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimers disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 18kDa |
| NCBI: | 5300 |
| UniProt: | Q13526 |
| Purity: | Affinity purification |
| Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE |
| Target: | PIN1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using Pin1 Rabbit pAb (A2106) at 1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Product Guarantee and Expert Support
