CD117 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A21301
- Images (1)
| Article Name: | CD117 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A21301 |
| Supplier Catalog Number: | A21301 |
| Alternative Catalog Number: | ABB-A21301-20UL,ABB-A21301-100UL,ABB-A21301-500UL,ABB-A21301-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | W, Bs, Fdc, Ssm, SCO1, SCO5, SOW3, CD117, c-KIT, Tr-kit, Gsfsco1, Gsfsco5, Gsfsow3 |
| The c-Kit proto-oncogene is the cellular homolog of the transforming gene of a feline retrovirus (v-Kit). The c-kit protein includes characteristics of a protein kinase transmembrane receptor. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 109kDa |
| NCBI: | 16590 |
| UniProt: | P05532 |
| Purity: | Affinity purification |
| Sequence: | SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLT |
| Target: | Kit |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from HeLa cells, using CD117 Rabbit pAb (A21301) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
