ARMC10 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A21304
- Images (1)
| Article Name: | ARMC10 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A21304 |
| Supplier Catalog Number: | A21304 |
| Alternative Catalog Number: | ABB-A21304-100UL,ABB-A21304-20UL,ABB-A21304-1000UL,ABB-A21304-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | SVH, PNAS112, PNAS-112, PSEC0198, ARMC10 |
| This gene encodes a protein that contains an armadillo repeat and transmembrane domain. The encoded protein decreases the transcriptional activity of the tumor suppressor protein p53 through direct interaction with the DNA-binding domain of p53, and may play a role in cell growth and survival. Upregulation of this gene may play a role in hepatocellular carcinoma. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 3. |
| Clonality: | Polyclonal |
| Molecular Weight: | 38kDa |
| NCBI: | 83787 |
| UniProt: | Q8N2F6 |
| Purity: | Affinity purification |
| Sequence: | TNMTVTNDHQHMLHSYITDLFQVLLTGNGNTKVQVLKLLLNLSENPAMTEGLLRAQVDSSFLSLYDSHVAKEILLRVLTLFQNIKNCLKIEGHLAVQPTFTEGSLFFLLHGEECAQKIRALVDHHDAEVKEKVVTIIPKI |
| Target: | ARMC10 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor biomarkers,Tumor suppressors,p53 pathway,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell cycle inhibitors. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ARMC10 Rabbit pAb (A21304) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
