MRP4/ABCC4 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A21322
- Images (1)
| Article Name: | MRP4/ABCC4 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A21322 |
| Supplier Catalog Number: | A21322 |
| Alternative Catalog Number: | ABB-A21322-20UL,ABB-A21322-100UL,ABB-A21322-1000UL,ABB-A21322-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | MRP4, MOATB, MOAT-B, MRP4/ABCC4 |
| The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This family member plays a role in cellular detoxification as a pump for its substrate, organic anions. It may also function in prostaglandin-mediated cAMP signaling in ciliogenesis. Alternative splicing of this gene results in multiple transcript variants. |
| Clonality: | Polyclonal |
| Molecular Weight: | 150kDa |
| NCBI: | 10257 |
| UniProt: | O15439 |
| Purity: | Affinity purification |
| Sequence: | SQEKVGIVGRTGAGKSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSIIPQEPVLFTGTMRKNLDPFNEHTDEELWNALQEVQLKETIEDLPGKMDTELAESGSNFSVGQRQLVCLARAILRKNQILIIDEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYVLLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPSTLTIF |
| Target: | ABCC4 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Stem Cells. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from HeLa cells, using MRP4/ABCC4 Rabbit pAb (A21322) at 1:1000 dilution. membrane protein extract isolated from Hela Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
