Chk1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A21348
- Images (1)
| Article Name: | Chk1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A21348 |
| Supplier Catalog Number: | A21348 |
| Alternative Catalog Number: | ABB-A21348-100UL,ABB-A21348-20UL,ABB-A21348-1000UL,ABB-A21348-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CHK1, Chk1 |
| The protein encoded by this gene belongs to the Ser/Thr protein kinase family. It is required for checkpoint mediated cell cycle arrest in response to DNA damage or the presence of unreplicated DNA. This protein acts to integrate signals from ATM and ATR, two cell cycle proteins involved in DNA damage responses, that also associate with chromatin in meiotic prophase I. Phosphorylation of CDC25A protein phosphatase by this protein is required for cells to delay cell cycle progression in response to double-strand DNA breaks. Several alternatively spliced transcript variants have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 54kDa |
| NCBI: | 1111 |
| UniProt: | O14757 |
| Purity: | Affinity purification |
| Sequence: | DFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDFSPVNSAS |
| Target: | CHEK1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Protein phosphorylation,Cancer,Signal Transduction,Kinase,Serine threonine kinases,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell Cycle Control-G1 S Checkpoint,Cell Cycle Control-G2 M DNA Damage Checkpoint. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using Chk1 Rabbit pAb (A21348) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer:3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: Q60s. |
Product Guarantee and Expert Support
