CSNK2A2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A21368
- Images (1)
| Article Name: | CSNK2A2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A21368 |
| Supplier Catalog Number: | A21368 |
| Alternative Catalog Number: | ABB-A21368-20UL,ABB-A21368-100UL,ABB-A21368-1000UL,ABB-A21368-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CK2A2, CSNK2A1, CK2alpha, CSNK2A2 |
| This gene encodes the alpha, or alpha 2, catalytic subunit of the protein kinase enzyme, casein kinase 2 (CK2). Casein kinase 2 is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. It is involved in various cellular processes, including cell cycle control, apoptosis, and circadian rhythms. This heterotetrameric kinase includes two catalytic subunits, either alpha or alpha, and two regulatory beta subunits. The closely related gene paralog encoding the alpha, or alpha 1 subunit (CSNK2A1, Gene ID: 1457) is found on chromosome 20. An intronic variant in this gene (alpha 2) may be associated with leukocyte telomere length in a South Asian population. A related transcribed pseudogene is found on chromosome 11. |
| Clonality: | Polyclonal |
| Molecular Weight: | 41kDa |
| NCBI: | 1459 |
| UniProt: | P19784 |
| Purity: | Affinity purification |
| Sequence: | MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEEL |
| Target: | CSNK2A2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Kinase. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using CSNK2A2 Rabbit pAb (A21368) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20s. |
Product Guarantee and Expert Support
