Lrwd1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A21399
Article Name: Lrwd1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A21399
Supplier Catalog Number: A21399
Alternative Catalog Number: ABB-A21399-20UL,ABB-A21399-100UL,ABB-A21399-500UL,ABB-A21399-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ORCA, CENP-33, Lrwd1
The protein encoded by this gene interacts with components of the origin recognition complex (ORC) and regulates the formation of the prereplicative complex. The encoded protein stabilizes the ORC and therefore aids in DNA replication. This protein is required for the G1/S phase transition of the cell cycle. In addition, the encoded protein binds to trimethylated histone H3 in heterochromatin and recruits the ORC and lysine methyltransferases, which help maintain the repressive heterochromatic state. Two transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 71kDa
NCBI: 222229
UniProt: Q9UFC0
Purity: Affinity purification
Sequence: ASPSAQVEGSPVAGSDGSQPAVKLEPLHFLQCHSKNNSPQDLETQLWACAFEPAWEEGATSQTVATCGGEAVCVIDCQTGIVLHKYKAPGEEFFSVAWTAL
Target: LRWD1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology & Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using Lrwd1 Rabbit pAb (A21399) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.