TTLL12 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A21407
- Images (1)
| Article Name: | TTLL12 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A21407 |
| Supplier Catalog Number: | A21407 |
| Alternative Catalog Number: | ABB-A21407-20UL,ABB-A21407-100UL,ABB-A21407-500UL,ABB-A21407-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | dJ526I14.2, TTLL12 |
| Enables H4K20me3 modified histone binding activity and tubulin binding activity. Involved in negative regulation of type I interferon-mediated signaling pathway and regulation of mitotic cell cycle. Located in cytoplasm. |
| Clonality: | Polyclonal |
| Molecular Weight: | 74kDa |
| NCBI: | 23170 |
| UniProt: | Q14166 |
| Purity: | Affinity purification |
| Sequence: | LFVYDVFWLRFSNRAFALNDLDDYEKHFTVMNYDPDVVLKQVHCEEFIPEFEKQYPEFPWTDVQAEIFRAFTELFQVACAKPPPLGLCDYPSSRAMYAVDLMLKWDNGPDGRRVMQPQILEVNFNPDCERACRYHPTFFNDVFSTLFLDQPGGCHVTCLV |
| Target: | TTLL12 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microtubules. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using TTLL12 Rabbit pAb (A21407) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
