Insulin Receptor Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A21466
Article Name: Insulin Receptor Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A21466
Supplier Catalog Number: A21466
Alternative Catalog Number: ABB-A21466-20UL,ABB-A21466-100UL,ABB-A21466-1000UL,ABB-A21466-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HHF5, CD220, Insulin Receptor
This gene encodes a member of the receptor tyrosine kinase family of proteins. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that form a heterotetrameric receptor. Binding of insulin or other ligands to this receptor activates the insulin signaling pathway, which regulates glucose uptake and release, as well as the synthesis and storage of carbohydrates, lipids and protein. Mutations in this gene underlie the inherited severe insulin resistance syndromes including type A insulin resistance syndrome, Donohue syndrome and Rabson-Mendenhall syndrome. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 156kDa
NCBI: 3643
UniProt: P06213
Purity: Affinity purification
Sequence: TKGRQERNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDP
Target: INSR
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Cancer,Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,AMPK Signaling Pathway,Insulin Receptor Signaling Pathway,Endocrine and metabolic diseases,Diabetes,Immunology Inflammation,CDs,Neuroscience,Cardiovascular,Heart,Cardiovascular diseases,Heart disease. Shipping: Ice Bag
Western blot analysis of various lysates, using Insulin Receptor Rabbit pAb (A21466) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.