Prion Protein Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A21570
Article Name: Prion Protein Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A21570
Supplier Catalog Number: A21570
Alternative Catalog Number: ABB-A21570-20UL,ABB-A21570-100UL,ABB-A21570-500UL,ABB-A21570-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CJD, GSS, PrP, ASCR, KURU, PRIP, PrPc, CD230, AltPrP, p27-30, PrP27-30, PrP33-35C, Prion Protein
The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that tends to aggregate into rod-like structures. The encoded protein contains a highly unstable region of five tandem octapeptide repeats. This gene is found on chromosome 20, approximately 20 kbp upstream of a gene which encodes a biochemically and structurally similar protein to the one encoded by this gene. Mutations in the repeat region as well as elsewhere in this gene have been associated with Creutzfeldt-Jakob disease, fatal familial insomnia, Gerstmann-Straussler disease, Huntington disease-like 1, and kuru. An overlapping open reading frame has been found for this gene that encodes a smaller, structurally unrelated protein, AltPrp. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 5621
UniProt: P04156
Purity: Affinity purification
Sequence: KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGS
Target: PRNP
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Immunology Inflammation,CDs,Neuroscience,Neurodegenerative Diseases,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag
Western blot analysis of lysates from mouse brain, using Prion Protein Rabbit pAb (A21570) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.