LRRK1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A21659
Article Name: LRRK1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A21659
Supplier Catalog Number: A21659
Alternative Catalog Number: ABB-A21659-100UL,ABB-A21659-20UL,ABB-A21659-1000UL,ABB-A21659-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: OSMD, RIPK6, Roco1, LRRK1
This gene encodes a multi-domain protein that is a leucine-rich repeat kinase and a GDP/GTP binding protein. The encoded protein is thought to play a role in the regulation of bone mass. Mice lacking a similar gene showed severe osteopetrosis, increased bone mineralization and decreased bone resorption.
Clonality: Polyclonal
Molecular Weight: 225kDa
NCBI: 79705
UniProt: Q38SD2
Purity: Affinity purification
Sequence: SMYWCVGPEESAVCPERAMETLNGAGDTGGKPSTRGGDPAARSRRTEGIRAAYRRGDRGGARDLLEEACDQCASQLEKGQL
Target: LRRK1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cancer,Signal Transduction,G protein signaling,Small G proteins,Kinase,Endocrine Metabolism,Amino acid metabolism,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from Raji cells usingLRRK1 Rabbit pAb (A21659) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.